10 Mar 2013 21:30
Re: sh: 1: Syntax error: "(" unexpected
Smithies, Russell <Russell.Smithies <at> agresearch.co.nz>
2013-03-10 20:30:36 GMT
2013-03-10 20:30:36 GMT
I'll get in first and say it's best to 'use strict', and 'use warnings'Perhaps some of the params to water have changed? It looks like it wants filenames, not objects. I get the same errors with your code - which I think is coming from water. If I do this it seems to work OK: --------------------------------------- #!/usr/bin/perl # get an EMBOSS factory use Bio::Factory::EMBOSS; use Bio::AlignIO; use Bio::SeqIO; use strict; use warnings; my $f = Bio::Factory::EMBOSS -> new(); # get an EMBOSS application object from the factory my $water = $f->program('water'); my $wateroutfile = 'out.water'; $water->run({ -verbose => 1, -asequence => 'krt1.fasta', -bsequence => 'krt2.fasta', -gapopen => '10.0', -gapextend => '0.5', -outfile => 'out.water'}); ------------------------------------------------ illustrious$ cat out.water ######################################## # Program: water # Rundate: Mon 11 Mar 2013 09:29:36 # Commandline: water # -gapopen 10.0 # -gapextend 0.5 # -outfile out.water # -asequence krt1.fasta # -verbose 1 # -bsequence krt2.fasta # -auto # Align_format: srspair # Report_file: out.water ######################################## #======================================= # # Aligned_sequences: 2 # 1: K2C1_HUMAN # 2: K22E_HUMAN # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 667 # Identity: 436/667 (65.4%) # Similarity: 499/667 (74.8%) # Gaps: 78/667 (11.7%) # Score: 2023.5 # # #======================================= K2C1_HUMAN 1 MSRQFSSRSGYRSGG-----GFSSGSAGIINYQRRTTSSSTRRSGGGGGR 45 ||.|.|.:|..|.|| |||||||.:....||:||| K22E_HUMAN 1 MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSS----------- 39 K2C1_HUMAN 46 FSSC----GGGGGSFGAGGGFGSRSLVNLGGSKSISISVARGGGRGSGFG 91 .|| |||||.|| ||||||||||.|||:|||||||| |||.|.|.. K22E_HUMAN 40 -FSCLSRHGGGGGGFG-GGGFGSRSLVGLGGTKSISISVA-GGGGGFGAA 86 K2C1_HUMAN 92 GGYG--
GGGFGGG-------GFGGGGFGGGGIGGGGFGGFGSGG--GGFG 130 ||:| ||||||| ||.||||||||.|||.|||||..| ||.| K22E_HUMAN 87 GGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLG 136 K2C1_HUMAN 131 G-GGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSR 179 | ||||.||| ||||.||::||||||||||::|||||.||:: K22E_HUMAN 137 GPGGFGPGGY---------PGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQ 177 K2C1_HUMAN 180 EREQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEP 229 ||||||:|||:|||||||||||||||||||||||||||::..||..|||| K22E_HUMAN 178 EREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGTRPINLEP 227 K2C1_HUMAN 230 YFESFINNLRRRVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTN 279 .|:.:|::|:|.:|.|.::::..:|||.||||:||||:.||||||||||. K22E_HUMAN 228 IFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKYEDEINKRTA 277 K2C1_HUMAN 280 AENEFVTIKKDVDGAYMTKVDLQAKLDNLQQEIDFLTALYQAELSQMQTQ 329 |||:|||:|||||.|||.||:||:|:|.|.|||:||..||.||:||:... K22E_HUMAN 278 AENDFVTLKKDVDNAYMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQS 327 K2C1_HUMAN 330 ISETNVILSMDNNRSLDLDSIIAEVKAQYEDIAQKSKAEAESLYQSKYEE 379 :::|||||||||:|:|||||||||||||||:|||:||.|||:||.||||| K22E_HUMAN 328 VTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIAQRSKEEAEALYHSKYEE 377 K2C1_HUMAN 380 LQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDA 429 ||:|.||||||::..||||||||||||||:.||.:||||..|:|.:|:|| K22E_HUMAN 378 LQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQDAIADA 427 K2C1_HUMAN 430 EQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEI 479 |||||:|||||:|||||||:|||||||||||||||||||||.|||||:|| K22E_HUMAN 428 EQRGEHALKDARNKLNDLEEALQQAKEDLARLLRDYQELMNVKLALDVEI 477 K2C1_HUMAN 480 ATYRTLLEGEESRMSGECAPNVSVSVSTSHTTISG--------GGSRGGG 521 ||||.||||||.||||:.:.||:|||::| |||. |||.|.| K22E_HUMAN 478 ATYRKLLEGEECRMSGDLSSNVTVSVTSS--TISSNVASKAAFGGSGGRG 525 K2C1_HUMAN 522 ---GGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGS 568 ||||.||.|||||||...||.||.||| ||. |||| ||| K22E_HUMAN 526 SSSGGGYSSGSSSYGSGGRQSGSRGGSGGG-GSI--------SGGG-YGS 565 K2C1_HUMAN 569 GGGGGGHGSYGSGSSSGGYRGGS-GGGGGGSSGGR-GSGGGSSGGSIGGR 616 |||.||. |||| ||.:||| .|||.||.||: .|||||.|||..|. K22E_HUMAN 566 GGGSGGR--YGSG---GGSKGGSISGGGYGSGGGKHSSGGGSRGGSSSGG 610 K2C1_HUMAN 617 GSSSGGVKSSGGSSSVK 633 |..||| ||||||| K22E_HUMAN 611 GYGSGG----GGSSSVK 623 #--------------------------------------- #--------------------------------------- --Russell -- -----Original Message----- From: bioperl-l-bounces <at> lists.open-bio.org [mailto:bioperl-l-bounces <at> lists.open-bio.org] On Behalf Of Antony03 Sent: Monday, 11 March 2013 2:17 a.m. To: Bioperl-l <at> lists.open-bio.org Subject: Re: [Bioperl-l] sh: 1: Syntax error: "(" unexpected Hi! Yes I'm sure, my script is exactly what I posted here. And I run it like this: anvin26 <at> anvin26:~/Bureau/emboss$ perl water.pl sh: 1: Syntax error: "(" unexpected So, I think there is no ambiguity (I run it like a perl script) and this why I don't understand why the script is run like a bash script! Leon Timmermans-2 wrote: > > On Sat, Mar 9, 2013 at 4:56 AM, Antony03 <antony.vincent.1 <at> ulaval.ca> > wrote: >> I'm trying to use emboss program (water or needle) with a bioperl script. >> I >> got this error when I try the script: sh: 1: Syntax error: "(" >> unexpected > > The error suggests the script is interpreted by the shell instead of > perl. Are you sure the hashbang (#!) is the absolute first thing in > the file. No whitespace or BOM character in the front? > > Leon > _______________________________________________ > Bioperl-l mailing list > Bioperl-l <at> lists.open-bio.org > http://lists.open-bio.org/mailman/listinfo/bioperl-l > > -- View this message in context: http://old.nabble.com/sh%3A-1%3A-Syntax-error%3A-%22%28%22-unexpected-tp35154292p35155738.html Sent from the Perl - Bioperl-L mailing list archive at Nabble.com. _______________________________________________ Bioperl-l mailing list Bioperl-l <at> lists.open-bio.org http://lists.open-bio.org/mailman/listinfo/bioperl-l ======================================================================= Attention: The information contained in this message and/or attachments from AgResearch Limited is intended only for the persons or entities to which it is addressed and may contain confidential and/or privileged material. Any review, retransmission, dissemination or other use of, or taking of any action in reliance upon, this information by persons or entities other than the intended recipients is prohibited by AgResearch Limited. If you have received this message in error, please notify the sender immediately. =======================================================================
Perhaps some of the params to water have changed? It looks like it wants filenames, not objects.
I get the same errors with your code - which I think is coming from water.
If I do this it seems to work OK:
---------------------------------------
#!/usr/bin/perl
# get an EMBOSS factory
use Bio::Factory::EMBOSS;
use Bio::AlignIO;
use Bio::SeqIO;
use strict;
use warnings;
my $f = Bio::Factory::EMBOSS -> new();
# get an EMBOSS application object from the factory
my $water = $f->program('water');
my $wateroutfile = 'out.water';
$water->run({ -verbose => 1,
-asequence => 'krt1.fasta',
-bsequence => 'krt2.fasta',
-gapopen => '10.0',
-gapextend => '0.5',
-outfile => 'out.water'});
------------------------------------------------
illustrious$ cat out.water
########################################
# Program: water
# Rundate: Mon 11 Mar 2013 09:29:36
# Commandline: water
# -gapopen 10.0
# -gapextend 0.5
# -outfile out.water
# -asequence krt1.fasta
# -verbose 1
# -bsequence krt2.fasta
# -auto
# Align_format: srspair
# Report_file: out.water
########################################
#=======================================
#
# Aligned_sequences: 2
# 1: K2C1_HUMAN
# 2: K22E_HUMAN
# Matrix: EBLOSUM62
# Gap_penalty: 10.0
# Extend_penalty: 0.5
#
# Length: 667
# Identity: 436/667 (65.4%)
# Similarity: 499/667 (74.8%)
# Gaps: 78/667 (11.7%)
# Score: 2023.5
#
#
#=======================================
K2C1_HUMAN 1 MSRQFSSRSGYRSGG-----GFSSGSAGIINYQRRTTSSSTRRSGGGGGR 45
||.|.|.:|..|.|| |||||||.:....||:|||
K22E_HUMAN 1 MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSS----------- 39
K2C1_HUMAN 46 FSSC----GGGGGSFGAGGGFGSRSLVNLGGSKSISISVARGGGRGSGFG 91
.|| |||||.|| ||||||||||.|||:|||||||| |||.|.|..
K22E_HUMAN 40 -FSCLSRHGGGGGGFG-GGGFGSRSLVGLGGTKSISISVA-GGGGGFGAA 86
K2C1_HUMAN 92 GGYG--
RSS Feed